Skip to content
  • Supplier
    • Supplier
    • Abbexa (99)
    • Abnova (99)
    • Active Motif (99)
    • Affinity (99)
    • BT Lab (99)
    • Bio-Rad (220)
    • Cloud Clone (99)
    • Columbia Bioscience (99)
    • Cusabio (99)
    • Cytoskeleton (98)
    • Dianova (98)
    • ELK (99)
    • Elab Science (99)
    • Everest (99)
    • Exalpha (99)
    • Fine Test (99)
    • GenScript (99)
    • Invent Technologies (78)
    • InvivoGen (100)
    • KHB (12)
    • Magtivio (219)
    • MedChemExpress (20)
    • Proteintech (693)
    • Santa Cruz (99)
    • Sanyou (99)
    • Solis BioDyne (64)
    • Souther Biotechnology (99)
    • Starlab (99)
    • Tianlong (101)
  • Product Type
    • Product Type
    • Accessories, Slides (3)
    • Accessories/Apparatus (23)
    • Accessory (6)
    • Activators (7)
    • Antibiotics Contamination (13)
    • Antibiotics Selection (26)
    • Antibodies (153)
    • Antibody (119)
    • Array/ Library (25)
    • Chromobody (6)
    • Competitive-ELISA (72)
    • Consumable Non-Reagent (22)
    • Consumable Reagent/Kit (64)
    • Control antibodies (2)
    • Control lysates (1)
    • DNA/RNA (74)
    • ELISA Kits (1)
    • ELISAKit (99)
    • FAST One-step RT-qPCR Kits, Probe-based (5)
    • FlexAble (97)
    • Hot-start PCR Enzymes and Master Mixes (5x), FAST cycling (10)
    • Hot-start PCR Enzymes and Master Mixes (5x), FAST cycling with UNG (10)
    • HumanKine (52)
    • HumanKine GMP grade (47)
    • Instrument (9)
    • Isothermal (10)
    • Kits (4)
    • Mounting Medium (Fluorescence), Accessory Reagents, (8)
    • Nano-Booster/Nano-Label (10)
    • Nano-Cap (2)
    • Nano-Trap (37)
    • Other Peptides (1)
    • PolyAbPolyAb (99)
    • Primary Antibodies (232)
    • Primary Antibodies;Antibody Collections;Antibody Pairs (99)
    • Primary Antibody Conjugates (78)
    • Reagent (2)
    • Recombinant secondary (31)
    • Reference Standards (1)
    • Reference compound (19)
    • Sandwich-ELISA (27)
    • Secondary Antibodies (64)
    • SecondaryAb (68)
    • Software (3)
    • Unconjugated (17)
    • VHH (18)
    • cDNA Synthesis Kits and Mixes (8)
    • conjugated (82)
    • human diagnostics (1)
    • qPCR Master Mixes, Dye-based (5x), FAST cycling (6)
  • Clonality
    • Clonality
    • ADC (6)
    • Isotype Control (4)
    • Monoclonal (234)
    • Multiclonal recombinant (31)
    • Polyclonal (603)
    • Recombinant (2)
  • Conjugation
    • Conjugation
    • Alkaline phosphatase (19)
    • Biotin (5)
    • CoraLite® Plus 488 (4)
    • CoraLite® Plus 555 (4)
    • CoraLite® Plus 594 (4)
    • CoraLite® Plus 647 (4)
    • CoraLite® Plus 750 (2)
    • DyLight® 488 (10)
    • DyLight® 550 (10)
    • DyLight® 650 (9)
    • HRP (72)
    • Polymer HRP (9)
    • SureLight™ Allophycocyanin (APC) (1)
    • SureLight™ R-phycoerythrin (3)
    • SureLight™ Allophycocyanin (7)
    • SureLight™ Allophycocyanin (APC) (9)
    • SureLight™ Peridinin-Chlorophyll (PerCP) (8)
    • SureLight™ R-Phycoerythrin (18)
    • Unconjugated (198)
    • UnconjugatedUnconjugated (99)
  • Application
    • Application
    • CISH-Ce (8)
    • CISH-P (62)
    • CISH-P,CISH-Ce (4)
    • COVID-19-immunoregulation (2)
    • Cancer-Kinase/protease (6)
    • Cancer-programmed cell death (6)
    • Colloidal Gold-Based, ELISA, IHC, WB (2)
    • Conjugation (2)
    • ELISA (106)
    • ELISA(peptide) (4)
    • ELISA, FACS, Kinetics (BLI), Kinetics (SPR), Functional assay (99)
    • ELISA, FLISA, FACS, IHC, IHC-P, IHC-F, IF, IP, WB (1)
    • ELISA, IHC, IHC-P, IHC-F, IF, IP, WB (1)
    • ELISA, IHC, IHC-P, IHC-F, WB (30)
    • ELISA, WB (84)
    • ELISA, WB, Dot blot (60)
    • ELISA, WB, IF/ICC (14)
    • ELISA, WB, IF/ICC, ChIP (1)
    • ELISA, WB, IHC (12)
    • ELISA, WB, IHC, DB, ChIP (2)
    • ELISA, WB, IHC, IF/ICC (8)
    • ELISA, WB, IHC, IF/ICC, ChIP (5)
    • ELISA, WB, IHC, IF/ICC, DB (3)
    • ELISA, WB, IHC, IF/ICC, DB, ChIP (6)
    • ELISA, WB, IHC, IF/ICC, IP (1)
    • ELISA, WB, IHC, IF/ICC, IP, ChIP (3)
    • ELISA, WB, IHC, IP (1)
    • ELISA, WB, IHC/ICC (9)
    • ELISA, WB, IP (3)
    • ELISA, WB,, Dot blot (1)
    • ELISA, WB,IHC (1)
    • ELISA|Dot blot (1)
    • ELISA|Dot blot|Immuno-affinity-chromatography|Immunocytochemistry|Immunohistochemistry (1)
    • ELISA|Immuno-affinity-chromatography|Immunocytochemistry|Immunohistochemistry (1)
    • ELISA|Immunoblotting|Immuno-affinity-chromatography|Immunocytochemistry|Immunohistochemistry|Flow Cytometry (1)
    • ELISA|Immunoblotting|Immunocytochemistry|Immunohistochemistry (1)
    • ELISA|Immunofluorescence (1)
    • Elution (3)
    • FC (11)
    • FC, IF (6)
    • FCM (3)
    • FLISA, FACS, IF (4)
    • FLISA, FACS, IF, WB (1)
    • FLISA, IF, WB (24)
    • Flow Cytometry (80)
    • Flow Cytometry|Direct Immunofluorescence (1)
    • Flow Cytometry|Immunocytochemistry|Immunohistochemistry (frozen)|Immunohistochemistry (paraffin) (1)
    • ICC, FCM (6)
    • IF (18)
    • IF, ELISA (4)
    • IF, FC (41)
    • IF, FC, IHC (9)
    • IF, FC, WB (57)
    • IF, Flow cyt (27)
    • IF, IHC(P), FCM (3)
    • IF, IHC, WB (12)
    • IF, Live cell imaging (6)
    • IF/ICC (3)
    • IF/ICC,IHC,WB (37)
    • IF/ICC,WB (10)
    • IHC (127)
    • IHC, FCM (26)
    • IHC, ICC (2)
    • IHC, ICC, FCM (10)
    • IHC, IF/ICC (1)
    • IHC,WB (14)
    • IHC-P, IHC-FR, IHC, IF (3)
    • IP (9)
    • IP, Co-IP (24)
    • IP, CoIP, ChIP, RIP (12)
    • IP, IF, FCM (1)
    • IP, WB (1)
    • IP, WB, ELISA (1)
    • Immunohistochemistry (paraffin)|Flow Cytometry|Immunocytochemistry (1)
    • Immunohistochemistry (paraffin)|Flow Cytometry|Immunohistochemistry (frozen) (1)
    • Immunohistochemistry|Immunohistochemistry (frozen)|Immunohistochemistry (paraffin)|Flow Cytometry (1)
    • Metabolism-sugar/lipid metabolism (1)
    • NIR-WB, IF, FCM (14)
    • Neuroscience-Neuromodulation (3)
    • Pep-ELISA (14)
    • Pep-ELISA, FC (1)
    • Pep-ELISA, FC, IF (1)
    • Pep-ELISA, IF (1)
    • Pep-ELISA, IF, FC (2)
    • Pep-ELISA, IHC (14)
    • Pep-ELISA, IHC, ICC (1)
    • Pep-ELISA, IHC, IF, FC (1)
    • Pep-ELISA, WB (27)
    • Pep-ELISA, WB, FC (2)
    • Pep-ELISA, WB, IF (2)
    • Pep-ELISA, WB, IF, FC (4)
    • Pep-ELISA, WB, IHC (25)
    • Pep-ELISA, WB, IHC, FC (1)
    • Pep-ELISA, WB, IHC, IF, FC (2)
    • Profiling (25)
    • Protein purification (2)
    • Rapid Test (1)
    • Sandwich ELISA (99)
    • Sandwich ELISA|dsRNA-immunoblotting|ELISA|Immunofluorescence (1)
    • WB (41)
    • WB (Fluorescent),IF, FC (2)
    • WB(RGB), IF, IHC(P), FCM (43)
    • WB, Dot blot (3)
    • WB, E (71)
    • WB, ELISA (15)
    • WB, FCM (8)
    • WB, ICC, FCM (6)
    • WB, IF, ELISA (2)
    • WB, IF, ELISA, IP (2)
    • WB, IF, IHC, ELISA (14)
    • WB, IF, IP (2)
    • WB, IHC(P), ELISA (9)
    • WB, IHC, E (28)
    • WB, IHC, ELISA (6)
    • WB, IHC, FCM (17)
    • WB, IHC, ICC, FCM (15)
    • WB, IHC, IF, ELISA (6)
    • WB, IHC, IF,ELISA (2)
    • WB, IHC, IF-P, IP, ELISA (2)
    • WB, IHC, IF/ICC, FC (Intra), ELISA (2)
    • WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA (2)
    • WB, IHC, IF/ICC, FC (Intra), IP, ELISA (3)
    • WB, IHC, IF/ICC, FC (Intra), IP, chIP, ELISA (2)
    • WB, IHC, IF/ICC, IP, CoIP, ELISA (1)
    • WB, IHC, IF/ICC, IP, ELISA (4)
    • WB, IHC, IP, ChIP, ELISA, IF (1)
    • WB, IP (1)
    • WB, IP, CoIP, ELISA (4)
    • WB, IP, ELISA (2)
    • WB, IP, IF (4)
    • WB, IP, IF, ELISA (3)
    • WB, IP, IF, FCM, ELISA (2)
    • WB, IP, IF, IHC(P) (3)
    • WB, IP, IF, IHC(P), FCM (3)
    • WB, IP, IF, IHC(P), FCM, ELISA (2)
    • WB, IP, IF, IHC, CoIP, ELISA (4)
    • WB, IP, IF, IHC, ELISA (4)
    • WB, IP, IF, IHC, ELISA, Cell treatment (2)
    • WB, IP, IF, RIP, IHC, ELISA (2)
    • WB, IP, IHC, ELISA (8)
    • WB, IP, IHC, ICC, FCM (1)
    • WB, IP, IHC, IF, ChIP, ELISA (2)
    • WB, IP, IHC, IF, CoIP, ChIP, ELISA (2)
    • WB, IP, IHC, IF, ELISA (12)
    • WB, IP, IHC, IF,ELISA (2)
    • WB, IP, KA (1)
    • WB, IP,ELISA (2)
    • WB, RIP, IP, CoIP, ChIP (1)
    • WB,IHC (5)
    • WB,IHC,IF/ICC (2)
    • WB; IHC; ICC; IP. (94)
    • WB; IHC; ICC; IP; FCM (2)
    • dsRNA-immunoblotting|ELISA|Immuno-affinity-chromatography|Immunocytochemistry|Immunohistochemistry (1)
    • dsRNA-immunoblotting|ELISA|Immunoblotting|Immuno-affinity-chromatography|Immunocytochemistry|Immunohistochemistry|Flow Cytometry (1)
    • dsRNA-immunoblotting|ELISA|Immunoblotting|Immunocytochemistry|Immunohistochemistry (1)
  • Host
    • Host
    • CHO (99)
    • Donkey (46)
    • Goat (153)
    • Guinea pig (1)
    • Mouse (304)
    • Rabbit (435)
    • RabbitRabbit (91)
    • rat (37)
  • Reactivity
    • Reactivity
    • 6X His tag (1)
    • Biotin (3)
    • Chicken (10)
    • Ciona intestinalis (3)
    • EP2 receptor (C-terminal amino acids 335-358; SLRTQDATQTSCSTQSDASKQADL). (1)
    • EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) (2)
    • FC Fragment (3)
    • Goat (23)
    • Guinea pig (4)
    • H (87)
    • Homo sapiens (Human) (53)
    • Horse (4)
    • Hu; (3)
    • Hu;Mu; (4)
    • Hu;Ra; (2)
    • Human (385)
    • Human/Mouse (3)
    • Human/Mouse/Rat (3)
    • Llama (2)
    • M (8)
    • Monkey (20)
    • Monoclonal antibody HA.11 was raised against the twelve amino acid peptide CYPYDVPDYASL. The HA.11 antibody recognizes the influenza hemagglutinin epitope (YPYDVPDYA) which has been used extensively as a general epitope tag in expression vectors. The HA.11 antibody recognizes HA epitopes located in the middle of protein sequences as well as at the N- or C-terminus. (3)
    • Mouse (221)
    • Mu; (7)
    • Mu;Po; (3)
    • Mu;Ra; (2)
    • Mu;Ra;Po; (2)
    • Mus musculus (Mouse) (30)
    • Po; (6)
    • Ra; (6)
    • Ra;Po; (1)
    • Rabbit (75)
    • RabbitRabbit (1)
    • Rat (101)
    • Rattus norvegicus (Rat) (16)
    • Recognizes the 9E10 epitope (EQKLISEEDL sequence) derived from the human c-myc protein. (4)
    • Rhesus Monkey (2)
    • Sheep (4)
    • Swine (4)
    • This kit recognizes Monkey Cortisol in samples.No significant cross-reactivity or interference between Monkey Cortisol and analogues was observed (3)
    • This kit recognizes Monkey E2 in samples.No significant cross-reactivity or interference between Monkey E2 and analogues was observed (3)
    • This kit recognizes Monkey E3 in samples.No significant cross-reactivity or interference between Monkey E3 and analogues was observed (3)
    • This kit recognizes Monkey Pg in samples.No significant cross-reactivity or interference between Monkey Pg and analogues was observed (3)
    • This kit recognizes Mouse CCL6 in samples. No significant cross-reactivity or interference between Mouse CCL6 and analogues was observed. (6)
    • This kit recognizes Mouse E2 in samples.No significant cross-reactivity or interference between Mouse E2 and analogues was observed (3)
    • This kit recognizes Mouse IgA in samples.No significant cross-reactivity or interference between Mouse IgA and analogues was observed (3)
    • This kit recognizes Mouse IgG in samples.No significant cross-reactivity or interference between Mouse IgG and analogues was observed (3)
    • This kit recognizes Mouse IgG2c in samples.No significant cross-reactivity or interference between Mouse IgG2c and analogues was observed (3)
    • This kit recognizes Mouse IgG3 in samples.No significant cross-reactivity or interference between Mouse IgG3 and analogues was observed (3)
    • This kit recognizes Mouse Pg in samples.No significant cross-reactivity or interference between Mouse Pg and analogues was observed (3)
    • This kit recognizes Porcine Cortisol in samples.No significant cross-reactivity or interference between Porcine Cortisol and analogues was observed (3)
    • This kit recognizes Porcine E2 in samples.No significant cross-reactivity or interference between Porcine E2 and analogues was observed (3)
    • This kit recognizes Porcine E3 in samples.No significant cross-reactivity or interference between Porcine E3 and analogues was observed (3)
    • This kit recognizes Porcine Pg in samples.No significant cross-reactivity or interference between Porcine Pg and analogues was observed (3)
    • This kit recognizes Porcine T in samples.No significant cross-reactivity or interference between Porcine T and analogues was observed (3)
    • This kit recognizes Rabbit Cortisol in samples.No significant cross-reactivity or interference between Rabbit Cortisol and analogues was observed (3)
    • This kit recognizes Rabbit E2 in samples.No significant cross-reactivity or interference between Rabbit E2 and analogues was observed (3)
    • This kit recognizes Rabbit Pg in samples.No significant cross-reactivity or interference between Rabbit Pg and analogues was observed (3)
    • This kit recognizes Rat ADP/Acrp30 in samples.No significant cross-reactivity or interference between Rat ADP/Acrp30 and analogues was observed (3)
    • This kit recognizes Rat Cort in samples.No significant cross-reactivity or interference between Rat Cort and analogues was observed (3)
    • This kit recognizes Rat E2 in samples.No significant cross-reactivity or interference between Rat E2 and analogues was observed (3)
    • This kit recognizes Rat E3 in samples.No significant cross-reactivity or interference between Rat E3 and analogues was observed (3)
    • This kit recognizes Rat IL-1R2 in samples.No significant cross-reactivity or interference between Rat IL-1R2 and analogues was observed (3)
    • This kit recognizes Rat IgG in samples.No significant cross-reactivity or interference between Rat IgG and analogues was observed (3)
    • This kit recognizes Rat Pg in samples.No significant cross-reactivity or interference between Rat Pg and analogues was observed (3)
    • This kit recognizes Rat T in samples.No significant cross-reactivity or interference between Rat T and analogues was observed (3)
    • This kit recognizes Sheep Cortisol in samples.No significant cross-reactivity or interference between Sheep Cortisol and analogues was observed (3)
    • This kit recognizes Sheep E2 in samples.No significant cross-reactivity or interference between Sheep E2 and analogues was observed (3)
    • This kit recognizes Sheep E3 in samples.No significant cross-reactivity or interference between Sheep E3 and analogues was observed (3)
    • This kit recognizes Sheep Pg in samples.No significant cross-reactivity or interference between Sheep Pg and analogues was observed (3)
    • This kit recognizes Sheep T in samples.No significant cross-reactivity or interference between Sheep T and analogues was observed (3)
    • bovine (21)
    • bovinemouse (2)
    • caenorhabditis elegans (2)
    • canine (5)
    • chicken (12)
    • chickenhuman (2)
    • dog (1)
    • duck (2)
    • duckhuman (2)
    • fish (1)
    • fishhuman (1)
    • goat (13)
    • goathuman (4)
    • hamster (6)
    • human (394)
    • humanhuman (20)
    • monkey (23)
    • monkeyrecombinant protein (1)
    • mouse (368)
    • mousehuman (50)
    • pig (39)
    • pighuman (2)
    • prawn (2)
    • prawnhuman (2)
    • rabbit (9)
    • rabbithuman (2)
    • rat (247)
    • rathuman (4)
    • recombinant protein (1)
    • sheep (2)
    • silkworm (1)
    • silkwormhuman (1)
    • turtle (4)
    • zebrafish (12)
    • zebrafishhuman (5)
  • Cas No
    • Cas No
    • 1035072-16-2 (1)
    • 112965-21-6 (1)
    • 1190379-70-4 (1)
    • 130495-35-1 (1)
    • 1360705-96-9 (1)
    • 1454585-06-8 (1)
    • 1609563-70-3 (1)
    • 1609563-71-4 (1)
    • 1644060-37-6 (1)
    • 1905481-36-8 (1)
    • 1957202-44-6 (1)
    • 2070009-45-7 (1)
    • 2070014-87-6 (1)
    • 2080306-21-2 (1)
    • 67330-25-0 (1)
    • 681159-27-3 (1)
    • 81485-25-8 (1)
    • 881681-00-1 (2)

Showing 601-650 of 3485

Per page: 50 100 200
  • Name
  • Supplier
  • Catalog No
  • Reactivity
  • Application
  • Conjugation
  • Clone
  • Size
  • Magtivio
  • Magnetic Separators
  • Magtivio
  • MagSi | Collection, Storage, Release
  • Magtivio
  • MagSi | Automation-ready Purification
1 11 12 13 14 15 70

Let’s connect!

Inquire now for tailored lab equipment and services.

Request a quote