D5-1866Anti-EP4 Receptor (C-term): SureLight™ R-PE;50ug

Article No
Size: 50ug
Shipping Information: Room Temperature
Delivery Info: The delivery time for this item is approximately 3-8 business days. If other deviations occur, this will be noted lorem ipsum dolor sit amet consectetur adipiscing elit. Lorem Ipsum has been the industry standard dummy text ever since the 1500s, when an unknown printer took a galley of type and scrambled it to make a type specimen book. It has survived not only five centuries, but also the leap into electronic typesetting, remaining essentially unchanged. It was popularised in the 1960s with the release of Letraset sheets containing Lorem Ipsum passages, and more recently with desktop publishing software like Aldus PageMaker including versions of Lorem Ipsum.

Specifications

Supplier: Columbia Bioscience
Catalog No: D5-1866
Product Name: Anti-EP4 Receptor (C-term): SureLight™ R-PE;50ug
Size: 50ug
Image: https://columbiabiosciences.com/wp-content/uploads/2018/11/products-R_PE_90x90__97269.1393253240.1280.1280.jpg
Host: Rabbit
Clonality: Polyclonal
Conjugation: SureLight™ R-Phycoerythrin
Target Immunogen: EP4 Receptor
Reactivity: EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)
Storage: Upon receipt, store at 2-8°C.

No documentation found.

No publications found.

Érdeklődjön a személyre szabott labor felszereléseinkről és szolgáltatásainkról.

Kérjen ajánlatot